missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin beta 8 Antibody (CL7290), Novus Biologicals™
Mouse Monoclonal Antibody
369.00€ - 504.00€
Specifications
| Antigen | Integrin beta 8 |
|---|---|
| Clone | CL7290 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Host Species | Mouse |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18321261
|
Novus Biologicals
NBP2-76480 |
100 μL |
504.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683721
|
Novus Biologicals
NBP2-76480-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Integrin beta 8 Monoclonal specifically detects Integrin beta 8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Integrin beta 8 | |
| Monoclonal | |
| Mouse | |
| integrin beta-8, integrin, beta 8 | |
| ITGB8 | |
| IgG1 | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL7290 | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 3696 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title