missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
IPCEF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68603
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
IPCEF1 Polyclonal antibody specifically detects IPCEF1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Tekniske data
| IPCEF1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| interaction protein for cytohesin exchange factors 1, interactor protein for cytohesin exchange factors 1, KIAA0403interaction protein for cytohesin exchange factors 1 Interaction protein forcytohesin exchange factors 1, phosphoinositide binding protein PIP3-E, Phosphoinositide-binding protein PIP3-E, PIP3-E, RP3-402L9.2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 26034 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion