missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCM9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00€ - 572.00€
Specifications
| Antigen | MCM9 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18423321
|
Novus Biologicals
NBP1-86740-25ul |
25 μL |
433.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18200907
|
Novus Biologicals
NBP1-86740 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MCM9 Polyclonal specifically detects MCM9 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MCM9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C6orf61, chromosome 6 open reading frame 61, dJ329L24.1, dJ329L24.3, DNA replication licensing factor MCM9, FLJ13942, FLJ20170, FLJ56845, hMCM9, MCMDC1, MGC35304, minichromosome maintenance complex component 9, Mini-chromosome maintenance deficient 9, minichromosome maintenance deficient domain containing 1, Mini-chromosome maintenance deficient domain-containing protein 1 | |
| MCM9 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 254394 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto