missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18068878

Novus Biologicals™ Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen

Code produit 18068878 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
0.1 mL
Conditionnement:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity Conditionnement
18068878 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18068878 Fournisseur Novus Biologicals™ Code fournisseur NBP192098PEP
 Restricted Item
Estimated Shipment: 03-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human METAP1D. The Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen is derived from E. coli. The Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-92098. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 254042
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol METAP1D
Label Type Unlabeled
Molecular Weight (g/mol) 26kDa
Product Type Methionine Aminopeptidase 1D/MAP1D
Quantity 0.1 mL
Regulatory Status RUO
Research Category Immunology
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92098. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.