missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MID1IP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 572.00€
Specifications
| Antigen | MID1IP1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18467230
|
Novus Biologicals
NBP1-84629-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18292977
|
Novus Biologicals
NBP1-84629 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MID1IP1 Polyclonal specifically detects MID1IP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MID1IP1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ10386, G12-like, Gastrulation-specific G12-like protein, MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like), Mid1-interacting G12-like protein, mid1-interacting protein 1, MIG12MID1 interacting G12-like protein, Protein STRAIT11499, S14R, Spot 14-R, Spot 14-related protein, STRAIT11499, THRSPL | |
| MID1IP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 58526 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title