missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Placental Lactogen/CSH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54710-25ul
This item is not returnable.
View return policy
Description
Placental Lactogen/CSH1 Polyclonal specifically detects Placental Lactogen/CSH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Placental Lactogen/CSH1 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Choriomammotropin, chorionic somatomammotropin hormone, chorionic somatomammotropin hormone 1 (placental lactogen), CS-1, CSAchorionic somatomammotropin A, CSH2, CSMT, FLJ75407, hCS-A, Lactogen, Placental lactogen, PLchoriomammotropin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CSH1 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF | |
| 25 μL | |
| Cytokine Research, Signal Transduction | |
| 1442 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction