missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Musculin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 589.00€
Specifications
| Antigen | Musculin |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18286344
|
Novus Biologicals
NBP2-56244 |
100 μL |
589.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608598
|
Novus Biologicals
NBP2-56244-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Musculin Polyclonal specifically detects Musculin in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Musculin | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ABF1, ABF-1activated B-cell factor 1, homolog of mouse musculin, Activated B-cell factor 1, BHLHA22, bHLHa22activated B-cell factor-1, Class A basic helix-loop-helix protein 22, musculin, musculin (activated B-cell factor-1), MYOR | |
| MSC | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9242 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title