missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYCBP Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93175-0.1ml
This item is not returnable.
View return policy
Description
MYCBP Polyclonal antibody specifically detects MYCBP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| MYCBP | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin | |
| AMY-1AMY1, Associate of Myc 1, associate of myc-1, c-myc binding protein, C-Myc-binding protein, FLJ41056 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2). MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE | |
| 0.1 mL | |
| Signal Transduction | |
| 26292 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion