missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
NFkB2/NFkB p100 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifikationer
| Antigen | NFkB2/NFkB p100 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
30232761
|
Novus Biologicals
NBP3-33345-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227090
|
Novus Biologicals
NBP3-33345-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
NFkB2/NFkB p100 Monoclonal antibody specifically detects NFkB2/NFkB p100 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifikationer
| NFkB2/NFkB p100 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| CVID10;H2TF1;LYT10;LYT-10;NF-kB2;Nuclear factor NF-kappa-B p100 subunit;p100;p49/p100;p52 | |
| A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NFkB2/NFkB p100 (NP_001070962.1).,, Sequence:, LRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 4791 | |
| IgG | |
| Affinity purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel