missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NIFK Antibody (CL2240), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-36749-25ul
This item is not returnable.
View return policy
Description
NIFK Monoclonal specifically detects NIFK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NIFK | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Human | |
| Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| CL2240 | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9BYG3 | |
| MKI67IP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 84365 | |
| Protein A purified | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. | |
| IgG2a |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction