missing translation for 'onlineSavingsMsg'
Learn More

NIPSNAP3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-46674

View more versions of this product

Product Code. 18624336

624.00€ / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

NIPSNAP3A Polyclonal antibody specifically detects NIPSNAP3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	NIPSNAP3A
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.	Q9BS92
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	DKFZp564D177, FLJ13953, HSPC299, MGC14553, nipsnap homolog 3A (C. elegans), NipSnap3A, NipSnap4, protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C, TassC
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
Quantity	0.1 mL
Research Discipline	Neuroscience
Gene ID (Entrez)	25934
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NIPSNAP3A Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions