missing translation for 'onlineSavingsMsg'
Learn More
Learn More
kinectin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | kinectin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
kinectin Polyclonal specifically detects kinectin in Human, Mouse samples. It is validated for Western Blot.Specifications
| kinectin | |
| Polyclonal | |
| Rabbit | |
| NP_001072990 | |
| 3895 | |
| Synthetic peptide directed towards the middle region of human KTN1. Peptide sequence EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| kinectin, kinectin 1 (kinesin receptor), MGC133337 | |
| KTN1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title