missing translation for 'onlineSavingsMsg'
Learn More

NT5C1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-49121-25ul

View more versions of this product

Product Code. 18629935

280.00€ / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

NT5C1A Polyclonal antibody specifically detects NT5C1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	NT5C1A
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	5'-nucleotidase, cytosolic IA, AMP-specific 5'-NT, CN1, cN1A, CN-I, cN-IA, cytosolic 5' nucleotidase, type 1A, cytosolic 5'-nucleotidase 1A, Cytosolic 5'-nucleotidase IA, EC 3.1.3.5, MGC119199, MGC119201
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA
Quantity	25 μL
Research Discipline	Lipid and Metabolism
Gene ID (Entrez)	84618
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

NT5C1A Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions