missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEA-15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62670-25ul
This item is not returnable.
View return policy
Description
PEA-15 Polyclonal antibody specifically detects PEA-15 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PEA-15 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| HMAT115kD, PEA-15, PED15 kDa phosphoprotein enriched in astrocytes, phosphoprotein enriched in astrocytes 15, Phosphoprotein enriched in diabetes | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD | |
| 25 μL | |
| Apoptosis, Cell Biology, Cellular Markers | |
| 8682 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction