missing translation for 'onlineSavingsMsg'
Learn More

Pin1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-21340-100ul

View more versions of this product

Product Code. 18665404

672.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Pin1 Polyclonal antibody specifically detects Pin1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	Pin1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	dod, EC 5.2.1.8, peptidyl-prolyl cis/trans isomerase, NIMA-interacting, peptidylprolyl cis/trans isomerase, NIMA-interacting 1, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, prolyl isomerase, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1, Rotamase Pin1, UBL5
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR
Quantity	100 μg
Research Discipline	Cell Cycle and Replication, Mitotic Regulators, Phospho Specific
Gene ID (Entrez)	5300
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Pin1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions