missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLAC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
368.00€ - 508.00€
Specifications
| Antigen | PLAC8 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18263984
|
Novus Biologicals
NBP2-58850 |
100 μL |
508.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601938
|
Novus Biologicals
NBP2-58850-25ul |
25 μL |
368.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PLAC8 Polyclonal specifically detects PLAC8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PLAC8 | |
| Polyclonal | |
| Rabbit | |
| Developmental Biology | |
| placenta-specific 8 | |
| PLAC8 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 51316 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('MNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF',) | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title