missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPM1J Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13797-25ul
This item is not returnable.
View return policy
Description
PPM1J Polyclonal antibody specifically detects PPM1J in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| PPM1J | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp434P1514, FLJ35951, MGC19531, MGC90149, PP2CZ, PP2Czeta, PP2C-zeta, PPP2CZEC 3.1.3.16, protein phosphatase 1J, protein phosphatase 1J (PP2C domain containing), protein phosphatase 2a, catalytic subunit, zeta isoform, Protein phosphatase 2C isoform zeta, protein phosphatase 2C zeta, protein phosphatase, Mg2+/Mn2+ dependent, 1J | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 333926 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction