missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPRK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 589.00€
Specifications
| Antigen | PTPRK |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18222512
|
Novus Biologicals
NBP2-58338 |
100 μL |
589.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634639
|
Novus Biologicals
NBP2-58338-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTPRK Polyclonal specifically detects PTPRK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PTPRK | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| DKFZp686C2268, DKFZp779N1045, EC 3.1.3.48, protein tyrosine phosphatase kappa protein tyrosine phosphatase kappa, protein tyrosine phosphatase, receptor type, K, Protein-tyrosine phosphatase kappa, protein-tyrosine phosphatase, receptor type, kappa, PTPK, receptor type, K (R-PTP-KAPPA, receptor-type tyrosine-protein phosphatase kappa | |
| PTPRK | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5796 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title