missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CENTB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69009
This item is not returnable.
View return policy
Description
CENTB1 Polyclonal antibody specifically detects CENTB1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| CENTB1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Arf GAP with coiled coil, ANK repeat and PH domains 1, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1, centaurin, beta 1, Centaurin-beta-1, CENTB1cnt-b1, Cnt-b1, KIAA0050centaurin-beta-1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK | |
| 100 μg | |
| Signal Transduction | |
| 9744 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction