missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPP38 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00€ - 470.00€
Specifications
| Antigen | RPP38 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609161
|
Novus Biologicals
NBP2-94050-0.02ml |
0.02 mL |
188.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18662072
|
Novus Biologicals
NBP2-94050-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPP38 Polyclonal antibody specifically detects RPP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| RPP38 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.3), 50% glycerol | |
| 10557 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.1.26.5, ribonuclease P (38kD) (RPP38), ribonuclease P protein subunit p38, ribonuclease P/MRP 38kDa subunit, RNaseP protein p38 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1). VVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title