missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SDSL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | SDSL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SDSL Polyclonal specifically detects SDSL in Human samples. It is validated for Western Blot.Specifications
| SDSL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 4.3.1.17, EC 4.3.1.19, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDH, SDH 2, SDS-RS1, Serine dehydratase 2, serine dehydratase related sequence 1, serine dehydratase-like, TDH | |
| SDSL | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96GA7 | |
| 113675 | |
| Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the N terminal of SDSL. Peptide sequence MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title