missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC1A5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
353.00€ - 557.00€
Specifications
| Antigen | SLC1A5 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18454661
|
Novus Biologicals
NBP1-89327-25ul |
25 μL |
353.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18288026
|
Novus Biologicals
NBP1-89327 |
0.1 mL |
557.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
SLC1A5 Polyclonal specifically detects SLC1A5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| SLC1A5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5 | |
| SLC1A5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| Q15758 | |
| 6510 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts