missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00€ - 572.00€
Specifications
| Antigen | SLC22A15 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18459990
|
Novus Biologicals
NBP1-84662-25ul |
25 μL |
433.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18240288
|
Novus Biologicals
NBP1-84662 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC22A15 Polyclonal specifically detects SLC22A15 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC22A15 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55356 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp761G0313, Flipt 1, FLIPT1PRO34686, fly-like putative organic ion transporter 1, Fly-like putative transporter 1, solute carrier family 22 (organic cation transporter), member 15, solute carrier family 22 member 15, solute carrier family 22, member 15, trans-like protein | |
| SLC22A15 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title