missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STING/TMEM173 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
278.00€ - 539.00€
Specifications
| Antigen | STING/TMEM173 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677226
|
Novus Biologicals
NBP2-48684 |
0.1 mL |
539.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18638796
|
Novus Biologicals
NBP2-48684-25ul |
25 μL |
278.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STING/TMEM173 Polyclonal antibody specifically detects STING/TMEM173 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| STING/TMEM173 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Immunology, Innate Immunity | |
| PBS (pH 7.2), 40% Glycerol | |
| 340061 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173 | |
| This STING/TMEM173 Antibody was developed against a recombinant protein corresponding to amino acids: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title