missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ TAP2 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA580096
This item is not returnable.
View return policy
Beschreibung
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell.
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces two products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.
Spezifikation
| TAP2 | |
| Polyclonal | |
| Unconjugated | |
| TAP2 | |
| ABC transporter, MHC 2; ABC18; ABCB3; AI462429; Antigen peptide transporter 2; APT2; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 3; ATP-binding cassette, sub-family B (MDR/TAP), member 3; Cim; D6S217E; Ham2; Ham-2; Histocompatibility antigen modifier 2; jas; MTP2; Peptide supply factor 2; peptide transporter involved in antigen processing 2; Peptide transporter PSF2; Peptide transporter TAP2; PSF2; PSF-2; Really interesting new gene 11 protein; RING11; TAP2; Tap-2; Transporter 2 ABC (ATP binding cassette); transporter 2 ATP-binding cassette sub-family B; transporter 2, ABC (ATP binding cassette); transporter 2, ATP binding cassette subfamily B member; transporter 2, ATP-binding cassette, sub-family B (MDR/TAP); Y1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 6891 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| Q03519 | |
| TAP2 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur