missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TATA binding protein TBP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38610-25ul
This item is not returnable.
View return policy
Description
TATA binding protein TBP Polyclonal specifically detects TATA binding protein TBP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TATA binding protein TBP | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P20226 | |
| TBP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS | |
| 25 μL | |
| Transcription Factors and Regulators | |
| 6908 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GTF2D, GTF2D1, HDL4, MGC126054, MGC126055, SCA17, TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box binding protein N-terminal domain, TATA-box factor, TATA-box-binding protein, TF2D, TFIIDMGC117320, Transcription initiation factor TFIID TBP subunit | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction