missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TFIIE beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-87931
This item is not returnable.
View return policy
Description
TFIIE beta Polyclonal specifically detects TFIIE beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TFIIE beta | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| FE, General transcription factor IIE subunit 2, general transcription factor IIE, polypeptide 2 (beta subunit, 34kD), general transcription factor IIE, polypeptide 2, beta 34kDa, TF2E2TFIIE-beta, TFIIE-B, transcription initiation factor IIE subunit beta | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human TFIIE beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GTF2E2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 2961 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction