missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMC5 Antibody - Azide and BSA Free, Novus Biologicals™

TMC5 Antibody - Azide and BSA Free, Novus Biologicals™

Artikelnummer. 18657031 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.02mL
0.1mL
Artikelnummer. Quantity unitSize
18657031 0.1 mL 0.1mL
18663380 0.02 mL 0.02mL
2 options
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18657031

Brand: Novus Biologicals NBP2938860.1ml

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

TMC5 Polyclonal antibody specifically detects TMC5 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen TMC5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 79838
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.