missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM184A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | TMEM184A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM184A Polyclonal specifically detects TMEM184A in Human samples. It is validated for Western Blot.Specifications
| TMEM184A | |
| Polyclonal | |
| Rabbit | |
| FLJ24011, transmembrane protein 184A | |
| TMEM184A | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 202915 | |
| Synthetic peptides corresponding to TMEM184A(transmembrane protein 184A) The peptide sequence was selected from the C terminal of TMEM184A. Peptide sequence CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title