missing translation for 'onlineSavingsMsg'
Learn More

TMTC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-62592

Product Code. 18543342

464.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

TMTC2 Polyclonal antibody specifically detects TMTC2 in Human samples. It is validated for Western Blot

Specifications

Antigen	TMTC2
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose
Gene Alias	DKFZp762A217, transmembrane and tetratricopeptide repeat containing 2, transmembrane and TPR repeat-containing protein 2
Immunogen	Synthetic peptides corresponding to TMTC2(transmembrane and tetratricopeptide repeat containing 2) The peptide sequence was selected form the N terminal of TMTC2. Peptide sequence SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK. The peptide sequence for this immunogen was taken from within the described region.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Concentration	0.5 mg/mL
Dilution	Western Blot 1.0 μg/mL
Gene Accession No.	Q8N394
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	160335
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

TMTC2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions