missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRPC5 Antibody (1C8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00007224-M10
This item is not returnable.
View return policy
Description
TRPC5 Monoclonal antibody specifically detects TRPC5 in Human samples. It is validated for Western Blot, ELISA
Specifications
| TRPC5 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| hTRP5, hTRP-5, short transient receptor potential channel 5, transient receptor potential cation channel, subfamily C, member 5, Transient receptor protein 5, TRP-5, TRP5transient receptor potential channel 5, TrpC5 | |
| TRPC5 (NP_036603, 534 a.a. ~ 603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT | |
| 0.1 mg | |
| Breast Cancer, Cancer | |
| 7224 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| 1C8 | |
| Western Blot, ELISA | |
| NP_036603 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction