missing translation for 'onlineSavingsMsg'
Learn More
Learn More
U1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | U1A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18467511
|
Novus Biologicals
NBP2-33465-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18170703
|
Novus Biologicals
NBP2-33465 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
U1A Polyclonal specifically detects U1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| U1A | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Mud1, small nuclear ribonucleoprotein polypeptide A, U1 snRNP A, U1 snRNP-specific protein A, U1-AU1 small nuclear ribonucleoprotein A, U1AU1 small nuclear RNP-specific A | |
| SNRPA | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| P09012 | |
| 6626 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit