missing translation for 'onlineSavingsMsg'
Learn More

YY2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-57462-25ul

View more versions of this product

Product Code. 18698828

415.00€ / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

YY2 Polyclonal specifically detects YY2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	YY2
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias	transcription factor YY2, YY2 transcription factor, ZNF631
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	404281
Target Species	Human
Form	Purified

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	YY2
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTL
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype	IgG

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

YY2 Antibody, Novus Biologicals™

Description

Specifications

Produktförslag

Dokument

Kampanjer