missing translation for 'onlineSavingsMsg'
Learn More

ADSSL1 Antibody, Novus Biologicals™

Product Code. 18227122 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18227122 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18227122 Supplier Novus Biologicals Supplier No. NBP155524

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ADSSL1 Polyclonal specifically detects ADSSL1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADSSL1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N142
Gene Alias adenylosuccinate synthase like 1, adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, ADSL1, AdSS 1, ADSS1, AMPSase 1, EC 6.3.4.4, FLJ38602, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase
Gene Symbols ADSSL1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ADSSL1(adenylosuccinate synthase like 1) The peptide sequence was selected from the middle region of ADSSL1 (NP_689541). Peptide sequence VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 122622
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.