missing translation for 'onlineSavingsMsg'
Learn More

AKAP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-54807

View more versions of this product

Product Code. 18242281

483.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

AKAP5 Polyclonal specifically detects AKAP5 in Human samples. It is validated for Western Blot.

Specifications

Antigen	AKAP5
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	A kinase (PRKA) anchor protein 5, AKAP 79, AKAP7979kDa, A-kinase anchor protein 79 kDa, A-kinase anchoring protein 75/79, cAMP-dependent protein kinase regulatory subunit II high affinity bindingprotein, cAMP-dependent protein kinase regulatory subunit II high affinity-bindingprotein, H21
Host Species	Rabbit
Molecular Weight of Antigen	47 kDa
Quantity	100 μL
Primary or Secondary	Primary
Test Specificity	Porcine: 86%; Equine: 86%; Yeast: 82%; .
Target Species	Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Yeast
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	P24588
Gene Symbols	AKAP5
Immunogen	Synthetic peptides corresponding to AKAP5(A kinase (PRKA) anchor protein 5) The peptide sequence was selected from the middle region of AKAP5 (NP_004848). Peptide sequence KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE.
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	9495
Reconstitution	Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

AKAP5 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions