missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKAP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | AKAP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AKAP5 Polyclonal specifically detects AKAP5 in Human samples. It is validated for Western Blot.Specifications
| AKAP5 | |
| Polyclonal | |
| Rabbit | |
| P24588 | |
| 9495 | |
| Synthetic peptides corresponding to AKAP5(A kinase (PRKA) anchor protein 5) The peptide sequence was selected from the middle region of AKAP5 (NP_004848). Peptide sequence KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A kinase (PRKA) anchor protein 5, AKAP 79, AKAP7979kDa, A-kinase anchor protein 79 kDa, A-kinase anchoring protein 75/79, cAMP-dependent protein kinase regulatory subunit II high affinity bindingprotein, cAMP-dependent protein kinase regulatory subunit II high affinity-bindingprotein, H21 | |
| AKAP5 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title