missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Angiomotin like 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92393-0.02ml
This item is not returnable.
View return policy
Description
Angiomotin like 1 Polyclonal antibody specifically detects Angiomotin like 1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Angiomotin like 1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| angiomotin like 1, angiomotin-like protein 1, JEAP, junction-enriched and associated protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human Angiomotin like 1 (NP_570899.1). LTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS | |
| 0.02 mL | |
| Cardiovascular Biology, Cytoskeleton Markers | |
| 154810 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction