missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Angiomotin like 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
226.00€ - 470.00€
Specifications
| Antigen | Angiomotin like 1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18645270
|
Novus Biologicals
NBP2-92393-0.02ml |
0.02 mL |
226.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653511
|
Novus Biologicals
NBP2-92393-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Angiomotin like 1 Polyclonal antibody specifically detects Angiomotin like 1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Angiomotin like 1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cytoskeleton Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 154810 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| angiomotin like 1, angiomotin-like protein 1, JEAP, junction-enriched and associated protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human Angiomotin like 1 (NP_570899.1). LTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title