missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15944365

Invitrogen™ Annexin A4 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15944365
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15944365 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15944365 Supplier Invitrogen™ Supplier No. PA578781

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human THP-1 whole cell, human Hacat whole cell, rat stomach tissue, rat lung tissue, mouse stomach tissue, mouse lung tissue. IHC: human breast cancer tissue, human colonic adenom tissue, human liver cancer tissue, human placenta tissue, mouse kidney tissue, rat kidney tissue. Flow: HEL cell.

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Annexin A4
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene ANXA4
Gene Accession No. P09525, P55260, P97429
Gene Alias 35-beta calcimedin; 36 kDa zymogen granule membrane-associated protein; AI265406; AIV; annexin 4; annexin A4; Annexin IV; annexin IV (placental anticoagulant protein II); annexin-4; ANX IV; ANX4; ANXA 4; Anxa4; ANXIV; AW106930; Carbohydrate-binding protein p33/p41; chromobindin-4; endonexin; endonexin I; epididymis secretory protein Li 274; HEL-S-274; Lipocortin IV; P32.5; p33/41 (annexin IV); PAP-II; PIG28; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; unnamed protein product; Xanx-4; ZAP 36/annexin IV; ZAP36; zymogen granule membrane associated protein
Gene Symbols ANXA4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11746, 307, 79124
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.