missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cathepsin X/Z/P Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38614-25ul
This item is not returnable.
View return policy
Description
Cathepsin X/Z/P Polyclonal specifically detects Cathepsin X/Z/P in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Cathepsin Z | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Simple Western 1:10, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9UBR2 | |
| CTSZ | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD | |
| 25 μL | |
| Cancer, Epitope Tags | |
| 1522 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cathepsin P, Cathepsin X, cathepsin Z, CTSX, EC 3.4.18.1, FLJ17088, preprocathepsin P | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction