missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cathepsin X/Z/P Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
278.00€ - 624.00€
Specifications
| Antigen | Cathepsin Z |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18633736
|
Novus Biologicals
NBP2-38614-25ul |
25 μL |
278.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18130179
|
Novus Biologicals
NBP2-38614 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cathepsin X/Z/P Polyclonal specifically detects Cathepsin X/Z/P in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Cathepsin Z | |
| Polyclonal | |
| Rabbit | |
| Cancer, Epitope Tags | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cathepsin P, Cathepsin X, cathepsin Z, CTSX, EC 3.4.18.1, FLJ17088, preprocathepsin P | |
| CTSZ | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9UBR2 | |
| 1522 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title