missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Centrin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84547
This item is not returnable.
View return policy
Description
Centrin 3 Polyclonal specifically detects Centrin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Centrin 3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| CDC31 yeast homolog, CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast), centrin, EF-hand protein, 3, centrin, EF-hand protein, 3 (CDC31 yeast homolog), centrin-3, EF-hand superfamily member, MGC12502, MGC138245 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CETN3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 1070 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction