missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Centrin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00€ - 572.00€
Specifications
| Antigen | Centrin 3 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489310
|
Novus Biologicals
NBP1-84547-25ul |
25 μL |
433.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18208227
|
Novus Biologicals
NBP1-84547 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Centrin 3 Polyclonal specifically detects Centrin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Centrin 3 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CDC31 yeast homolog, CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast), centrin, EF-hand protein, 3, centrin, EF-hand protein, 3 (CDC31 yeast homolog), centrin-3, EF-hand superfamily member, MGC12502, MGC138245 | |
| CETN3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1070 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title