missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTGF/CCN2 Antibody (CL5339), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-61415
This item is not returnable.
View return policy
Description
CTGF/CCN2 Monoclonal specifically detects CTGF/CCN2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CTGF/CCN2 | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CCN2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG | |
| 100 μL | |
| Primary | |
| Specificity of human CTGF/CCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| Western Blot, Immunohistochemistry (Paraffin) | |
| CL5339 | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CCN2IGFBP-8, connective tissue growth factor, HCS24, Hypertrophic chondrocyte-specific protein 24, IBP-8, IGF-binding protein 8, IGFBP8CCN family member 2, Insulin-like growth factor-binding protein 8, MGC102839, NOV2 | |
| Mouse | |
| Protein A purified | |
| Angiogenesis, Cancer, Cell Biology, Cytokine Research, Growth and Development, Immunology, Innate Immunity | |
| 1490 | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction