missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTGF/CCN2 Antibody (CL5339), Novus Biologicals™
Mouse Monoclonal Antibody
302.00€ - 500.00€
Specifications
| Antigen | CTGF/CCN2 |
|---|---|
| Clone | CL5339 |
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18265701
|
Novus Biologicals
NBP2-61415 |
100 μL |
500.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18680117
|
Novus Biologicals
NBP2-61415-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CTGF/CCN2 Monoclonal specifically detects CTGF/CCN2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CTGF/CCN2 | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| Mouse | |
| Human, Mouse, Rat | |
| 1490 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG | |
| Primary | |
| Specificity of human CTGF/CCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL5339 | |
| Monoclonal | |
| Purified | |
| Angiogenesis, Cancer, Cell Biology, Cytokine Research, Growth and Development, Immunology, Innate Immunity | |
| CCN2IGFBP-8, connective tissue growth factor, HCS24, Hypertrophic chondrocyte-specific protein 24, IBP-8, IGF-binding protein 8, IGFBP8CCN family member 2, Insulin-like growth factor-binding protein 8, MGC102839, NOV2 | |
| CCN2 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title