missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DARC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86586
This item is not returnable.
View return policy
Description
DARC Polyclonal antibody specifically detects DARC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| DARC | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CCBP1, CD234, CD234 antigen, Dfy, Duffy antigen/chemokine receptor, Duffy blood group antigen, Duffy blood group, chemokine receptor, Fy glycoprotein, FYDuffy blood group, Glycoprotein D, GPDWBCQ1, GpFy, Plasmodium vivax receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS | |
| 0.1 mL | |
| GPCR, Immunology, Innate Immunity | |
| 2532 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction