missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DARC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00€ - 529.00€
Specifications
| Antigen | DARC |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18480831
|
Novus Biologicals
NBP1-86586 |
0.1 mL |
529.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18465231
|
Novus Biologicals
NBP1-86586-25ul |
25 μL |
386.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DARC Polyclonal antibody specifically detects DARC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DARC | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| GPCR, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2532 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CCBP1, CD234, CD234 antigen, Dfy, Duffy antigen/chemokine receptor, Duffy blood group antigen, Duffy blood group, chemokine receptor, Fy glycoprotein, FYDuffy blood group, Glycoprotein D, GPDWBCQ1, GpFy, Plasmodium vivax receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title