missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79717
This item is not returnable.
View return policy
Description
DUSP5 Polyclonal specifically detects DUSP5 in Human samples. It is validated for Western Blot.
Specifications
| DUSP5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| dual specificity phosphatase 5, dual specificity protein phosphatase 5, Dual specificity protein phosphatase hVH3, DUSP, EC 3.1.3.16, EC 3.1.3.48, HVH3VH1-like phosphatase 3, serine/threonine specific protein phosphatase, VH3 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Protein Phosphatase | |
| 1847 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_004410 | |
| DUSP5 | |
| Synthetic peptide directed towards the middle region of human DUSP5. Peptide sequence: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID | |
| Affinity purified | |
| RUO | |
| Primary | |
| Predicted Homology Based On Immunogen Sequence: Bovine 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction