missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | DUSP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DUSP5 Polyclonal specifically detects DUSP5 in Human samples. It is validated for Western Blot.Specifications
| DUSP5 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| dual specificity phosphatase 5, dual specificity protein phosphatase 5, Dual specificity protein phosphatase hVH3, DUSP, EC 3.1.3.16, EC 3.1.3.48, HVH3VH1-like phosphatase 3, serine/threonine specific protein phosphatase, VH3 | |
| DUSP5 | |
| IgG | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_004410 | |
| 1847 | |
| Synthetic peptide directed towards the middle region of human DUSP5. Peptide sequence: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title