missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GPR109B/HM74 Antibody, Novus Biologicals™

GPR109B/HM74 Antibody, Novus Biologicals™

Product Code. 30231459 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30231459 20 μL 20µL
30227051 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30231459 Supplier Novus Biologicals Supplier No. NBP33583020ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GPR109B/HM74 Polyclonal antibody specifically detects GPR109B/HM74 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen GPR109B/HM74
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias G protein-coupled receptor 109B, G-protein coupled receptor 109B, G-protein coupled receptor HM74, G-protein coupled receptor HM74B, GTP-binding protein, HCA3, HCAR3, HM74B, HM74Puma-g, Niacin receptor 2, NIACR2, Nicotinic acid receptor 2, PUMAG, putative chemokine receptor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-392 of human GPR109B/HM74 (NP_006009.2).,, Sequence:, SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, GPCR, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 8843
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.